PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G004000.1
Common NamePHAVU_006G004000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 193aa    MW: 21361.4 Da    PI: 6.7482
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G004000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.81.6e-10110150445
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         W ++E+ ll++a++++G g+ + +a+++g +++  qc+++++
  Phvul.006G004000.1 110 WNADEEMLLLEAIEMYGFGNGNEVAEYVG-TKSKSQCIDHYN 150
                         *****************************.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM002912.9E-104691IPR000433Zinc finger, ZZ-type
PfamPF005698.6E-95088IPR000433Zinc finger, ZZ-type
PROSITE profilePS5013510.615093IPR000433Zinc finger, ZZ-type
CDDcd023352.09E-245098No hitNo description
SuperFamilySSF578507.33E-1550113No hitNo description
PROSITE patternPS0135705279IPR000433Zinc finger, ZZ-type
SuperFamilySSF466891.87E-10102156IPR009057Homeodomain-like
PROSITE profilePS5129319.562105157IPR017884SANT domain
SMARTSM007176.2E-8106155IPR001005SANT/Myb domain
PfamPF002496.8E-10109150IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-5110151IPR009057Homeodomain-like
CDDcd001672.62E-11110150No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MGRCRAASAS GPADDDPNLR LKRKKAALST ENSETLPTGQ GIANSKVSLY HCNYCNKDIS  60
GRIRIKCAVC QDFDLCIECF SVGAEVTPHK CNHPYRIMDN LSFPLICPDW NADEEMLLLE  120
AIEMYGFGNG NEVAEYVGTK SKSQCIDHYN AVYMNSPCFP LPDLSHVMGK SRDELFAMVK  180
VHEAKKGLFL KN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150386e-71AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007145993.11e-144hypothetical protein PHAVU_006G004000g
SwissprotQ75LL64e-86TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLV7BJ691e-144V7BJ69_PHAVU; Uncharacterized protein
STRINGGLYMA13G11200.21e-120(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15371726